PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo18G0015900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Nin-like
Protein Properties Length: 243aa    MW: 27313.6 Da    PI: 9.1335
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo18G0015900genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.71.8e-26118168252
           RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      ++++ +ed+sk+F++pi++AAk + v+lTvLK++CR++GI+RWPhRk+ksl
  Spipo18G0015900 118 TSSMAFEDISKFFYMPITEAAKAMRVGLTVLKKRCRELGISRWPHRKMKSL 168
                      67899********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.848104188IPR003035RWP-RK domain
PfamPF020421.1E-21121168IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MATFFQCCCS HLPLCGGHLC QSPSIYPPII LPLAEAPPQD LYLPPDQLST AMDFDFNFNL  60
DSIALEDAAL LDFRVETPPA APPHHQHQHH QRHQSAAARH PGEGSGGLRQ AAPARPRTSS  120
MAFEDISKFF YMPITEAAKA MRVGLTVLKK RCRELGISRW PHRKMKSLTS LIHNVQELGK  180
GAAMEDSVRR EIETLEEHKR LLEMMPEMQL TERTKKLRQA CFKANFKKRR ASQLPSPRSL  240
SI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9M9U95e-40RKD1_ARATH; Protein RKD1
TrEMBLA0A0K9PWD42e-56A0A0K9PWD4_Z
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45903365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.15e-41RWP-RK domain-containing protein